PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.7G064400.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB
Protein Properties Length: 978aa    MW: 110019 Da    PI: 4.91
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.7G064400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding43.19.8e-14853248
                        SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        g W   Ede+l+ av ++G+++W++I++ +  ++++kqck rw+ +l
  Sevir.7G064400.1.p  8 GVWKNTEDEILKAAVMKYGKNQWARISSLLV-RKSAKQCKARWYEWL 53
                        78*****************************.************986 PP

2Myb_DNA-binding32.81.6e-1060103248
                         SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                           WT eEde+l+++ k++++  W+tIa  +g  Rt+ qc +r+ k+l
  Sevir.7G064400.1.p  60 TEWTREEDEKLLHLAKLMPTQ-WRTIAPIVG--RTPSQCLERYEKLL 103
                         68*****************99.********8..**********9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129422.008257IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.7E-18556IPR009057Homeodomain-like
SMARTSM007177.0E-15655IPR001005SANT/Myb domain
PfamPF139214.5E-131070No hitNo description
CDDcd001675.91E-121053No hitNo description
SuperFamilySSF466896.47E-2133108IPR009057Homeodomain-like
CDDcd116591.66E-3055106No hitNo description
Gene3DG3DSA:1.10.10.603.4E-1457104IPR009057Homeodomain-like
PROSITE profilePS5129416.44358107IPR017930Myb domain
SMARTSM007171.7E-1258105IPR001005SANT/Myb domain
PfamPF118315.4E-59406658IPR021786Pre-mRNA splicing factor component Cdc5p/Cef1
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009870Biological Processdefense response signaling pathway, resistance gene-dependent
GO:0010204Biological Processdefense response signaling pathway, resistance gene-independent
GO:0042742Biological Processdefense response to bacterium
GO:0050832Biological Processdefense response to fungus
GO:0009507Cellular Componentchloroplast
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 978 aa     Download sequence    Send to blast
MRIMIKGGVW KNTEDEILKA AVMKYGKNQW ARISSLLVRK SAKQCKARWY EWLDPSIKKT  60
EWTREEDEKL LHLAKLMPTQ WRTIAPIVGR TPSQCLERYE KLLDAACAKD ENYEPNDDPR  120
KLRPGEIDPN PESKPARPDP VDMDEDEKEM LSEARARLAN TRGKKAKRKA REKQLEEARR  180
LASLQKRREL KAAGIDTRQR KRKRKGIDYN AEIAFEKRPP PGFYDTVGED KPPEHVQFPT  240
TIEELEGKRR VDIEAQLRKQ DIARNKILQR QDAPAAIMQA NKLNDPEAVT KRSKLMLPPP  300
QISDHELEEI AKMGSAGDPA LAEELGEGST ATRALLSSYS QTPRLGMTPL RTPQRTPAGK  360
GDAIMMEAEN LARLRESQTP LLGGDNPDLH PSDFSGVTPR KKEIQTPNPM ATPLALASPG  420
PGATPRIGMT PSRDGNSFGL TPKATPFRDE LRINEEVELQ DSAKLELRRQ AELRKSLRSG  480
FASIPQPKNE YQIVMPPITE DEKEEAEERI EEDMSDRLAR ERAEEQARQE ALLRKRSKVL  540
QRSLPRPPAA SVEVLRQSLI KGGESRSRST FVPPTSLEQA DDLIHEELLR LLEHDNTKYP  600
LDDKTQKEKK KGNKRQANAA AVPEIEDFDE YELKEASSLV EEEIQYLRVA MGHESESFDD  660
FVKAHDACQE DLMYFPANNS YGLASVAGNA DKISALQNEF EIVKKRMDDE AKKASRLEQK  720
IKLLTQGYQV RAGKLWSQVQ DTFKQMDTAA TELECFQELQ KQEQLAASYR VRNLTEEVDK  780
QKALERTLQS RYGDLVSIYH RMQEQLEEHK IQLRKQEAIE AENRAREEAA AQNRADEEEN  840
ERRRNVEEGK EQTNSVPDEV PAGSKQINED QMDVDSSNVD GEFVGPIPPA PDTQGDSTEA  900
SVQENSSNAQ SGDDVTTNGE ACDMVDASKL ESQDNSNGSL PVDAVNQEDN KSNLPLVGAS  960
EGNTALSSDG DDAVTNE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3jb9_W1e-10232242236Pre-mRNA-splicing factor cdc5
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1185204KRRELKAAGIDTRQRKRKRK
2199204RKRKRK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00028SELEXTransfer from AT1G09770Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004975336.10.0PREDICTED: cell division cycle 5-like protein
SwissprotP929480.0CDC5L_ARATH; Cell division cycle 5-like protein
TrEMBLK3Y4Y00.0K3Y4Y0_SETIT; Uncharacterized protein
STRINGSi009268m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP44163553
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G09770.10.0cell division cycle 5